| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PI 3-Kinase p110 delta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PI 3-Kinase p110 delta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PI 3-Kinase p110 delta. This antibody reacts with human. The PI 3-Kinase p110 delta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PI 3-Kinase p110 delta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN |
|---|
| Other Names | EC 2.7.1, EC 2.7.1.153, p110D, P110DELTA, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform, phosphoinositide-3-kinase C, phosphoinositide-3-kinase, catalytic, delta polypeptide, PI3K, PI3K-delta, PI3-kinase p110 subunit delta, PI3-kinase subunit delta, PtdIns-3-kinase subunit delta, PtdIns-3-kinase subunit p110-delta |
|---|
| Gene, Accession # | PIK3CD, Gene ID: 5293 |
|---|
| Catalog # | NBP2-38535 |
|---|
| Price | |
|---|
| Order / More Info | PI 3-Kinase p110 delta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|