| Edit |   |
|---|
| Antigenic Specificity | Cholecystokinin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cholecystokinin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cholecystokinin. This antibody reacts with human. The Cholecystokinin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCK(cholecystokinin) The peptide sequence was selected from the middle region of CCK (NP_071919). IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS. |
|---|
| Other Names | cholecystokinin, MGC117187 |
|---|
| Gene, Accession # | CCK, Gene ID: 885, Accession: P06307, SwissProt: P06307 |
|---|
| Catalog # | NBP1-59329 |
|---|
| Price | |
|---|
| Order / More Info | Cholecystokinin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|