| Edit |   |
| Antigenic Specificity | LOC284009 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LOC284009 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LOC284009. This antibody reacts with human. The LOC284009 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC284009(hypothetical protein LOC284009) The peptide sequence was selected from the N terminal of LOC284009. Peptide sequence IRCGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVPFLAQGIPDI. |
| Other Names | hypothetical LOC284009, MGC138239 |
| Gene, Accession # | LOC284009, Gene ID: 284009 |
| Catalog # | NBP1-70605-20ul |
| Price | |
| Order / More Info | LOC284009 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |