| Edit |   |
|---|
| Antigenic Specificity | LOC388813 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LOC388813 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LOC388813. This antibody reacts with human. The LOC388813 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LOC388813 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KTVNDKIWQEHSKHKNDSHIRRPCQLKDLNEDDFLSNNIHTYQGKTLQGT SYQVTSECWSPFHYQRHVETTVDELVRHFFPDVT |
|---|
| Other Names | LOC388813 uncharacterized protein ENSP00000383407-like |
|---|
| Gene, Accession # | LOC388813, Gene ID: 388813 |
|---|
| Catalog # | NBP2-14572 |
|---|
| Price | |
|---|
| Order / More Info | LOC388813 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|