| Edit |   |
|---|
| Antigenic Specificity | LOC645015 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LOC645015 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LOC645015. This antibody reacts with human. The LOC645015 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC645015(similar to mannosyltransferase) The peptide sequence was selected from the middle region of LOC645015. Peptide sequence LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD. |
|---|
| Other Names | asparagine-linked glycosylation 1-like 8, pseudogene, LOC645015 asparagine-linked glycosylation 1 homolog pseudogene |
|---|
| Gene, Accession # | LOC645015, Gene ID: 645015 |
|---|
| Catalog # | NBP1-70612-20ul |
|---|
| Price | |
|---|
| Order / More Info | LOC645015 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|