| 产品详情 |
| Edit |   |
| Antigenic Specificity | STMN1 / Stathmin / LAG, aa2-34 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse, dog, sheep, bovine, rat, porcine, horse, bat, human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | n/a |
| Concentration | n/a |
| Applications | IHC, IHC-P (0.5 - 1 µg/ml), WB (0.1 - 0.5 µg/ml) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | STMN1 / Stathmin / LAG Antibody (aa2-34) LS-C407775. Specificity: Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia. |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. |
| Other Names | STMN1, C1orf215, Lag, LAP18, OP18, Phosphoprotein p19, Phosphoprotein 19, PP17, PP19, PR22, Protein Pr22, Transmembrane protein C1orf215, Oncoprotein 18, Prosolin, SMN, Metablastin, Stathmin, Stathmin 1 |
| Gene, Accession # | STMN1, Gene ID: 3925 |
| Catalog # | LS-C407775 |
| Price | |
| Order / More Info | STMN1 / Stathmin / LAG, aa2-34 Antibody from LIFESPAN BIOSCIENCES INC. |
| Product Specific References | n/a |
| 产品资料 |
|
|