| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GRAF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRAF Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRAF. This antibody reacts with human. The GRAF Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GRAF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE |
|---|
| Other Names | FLJ42530, GRAFGTPase regulator associated with focal adhesion kinase pp125(FAK), KIAA0621rho GTPase-activating protein 26, Oligophrenin-1-like protein, OPHN1L1, OPHN1LGTPase regulator associated with focal adhesion kinase, Rho GTPase activating protein 26, Rho-type GTPase-activating protein 26 |
|---|
| Gene, Accession # | ARHGAP26, Gene ID: 23092, Accession: Q9UNA1, SwissProt: Q9UNA1 |
|---|
| Catalog # | NBP2-38235 |
|---|
| Price | |
|---|
| Order / More Info | GRAF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|