| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMH / Anti-Mullerian Hormone |
|---|
| Clone | 5/6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | mouse, porcine, human, monkey |
|---|
| Isotype | IgG1 |
|---|
| Format | supernatant |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, IHC-P (1:20 - 1:40), WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | AMH / Anti-Mullerian Hormone Antibody (clone 5/6) LS-C188251. Specificity: Is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. Plays a role in testicular differentiation and in the regulation of ovarian follicle growth. Is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. |
|---|
| Immunogen | Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Galago, Marmoset, Mouse, Pig (100%); Panda, Dog, Bovine (97%); Rat, Guinea pig (94%). |
|---|
| Other Names | AMH, Anti-Muellerian hormone, Anti-Mullerian hormone, Muellerian-inhibiting factor, Mullerian inhibiting factor, Mullerian inhibiting substance, MIS |
|---|
| Gene, Accession # | AMH, Gene ID: 268 |
|---|
| Catalog # | LS-C188251 |
|---|
| Price | |
|---|
| Order / More Info | AMH / Anti-Mullerian Hormone Antibody from LIFESPAN BIOSCIENCES INC. |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|