| Edit |   |
| Antigenic Specificity | Cklfsf8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cklfsf8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cklfsf8. This antibody reacts with human. The Cklfsf8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CMTM8(CKLF-like MARVEL transmembrane domain containing 8) The peptide sequence was selected from the middle region of CMTM8. Peptide sequence CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN. |
| Other Names | chemokine-like factor super family 8, chemokine-like factor superfamily 8, Chemokine-like factor superfamily member 8, CKLF-like MARVEL transmembrane domain containing 8, CKLF-like MARVEL transmembrane domain-containing protein 8, CKLFSF8, CKLFSF8-V2 |
| Gene, Accession # | CMTM8, Gene ID: 152189, Accession: Q8IZV2, SwissProt: Q8IZV2 |
| Catalog # | NBP1-59463 |
| Price | |
| Order / More Info | Cklfsf8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |