| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZRSR2 |
|---|
| Clone | 2H5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZRSR2 Antibody (2H5) from Novus Biologicals is a mouse monoclonal antibody to ZRSR2. This antibody reacts with human. The ZRSR2 Antibody (2H5) has been validated for the following applications: ELISA. |
|---|
| Immunogen | U2AF1L2 (NP_005080.1 294 a.a. - 393 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG |
|---|
| Other Names | CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2, Renal carcinoma antigen NY-REN-20, U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-relatedprotein 2, U2 small nuclear ribonucleoprotein auxiliary factor, small subunit 2, U2(RNU2) small nuclear RNA auxiliary factor 1-like 2MGC142014, U2AF1L2, U2AF1RS2MGC142040, U2AF1-RS2U2AF35-related protein, URPU2 small nuclear RNA auxiliary factor 1-like 2, zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2 |
|---|
| Gene, Accession # | ZRSR2, Gene ID: 8233, Accession: NP_005080, SwissProt: NP_005080 |
|---|
| Catalog # | H00008233-M03 |
|---|
| Price | |
|---|
| Order / More Info | ZRSR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|