| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STEAP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STEAP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STEAP2. This antibody reacts with human. The STEAP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human STEAP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIE |
|---|
| Other Names | EC 1.16.1, EC 1.16.1.-, IPCA1, metalloreductase STEAP2, PCANAP1STMP, prostate cancer associated protein 1, Prostate cancer-associated protein 1, Protein upregulated in metastatic prostate cancer, PUMPCn, six transmembrane epithelial antigen of prostate 2, six transmembrane epithelial antigen of the prostate 2, Six-transmembrane epithelial antigen of prostate 2, SixTransMembrane protein of prostate 1, STAMP1IPCA-1 |
|---|
| Gene, Accession # | STEAP2, Gene ID: 261729 |
|---|
| Catalog # | NBP1-83100 |
|---|
| Price | |
|---|
| Order / More Info | STEAP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|