| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CYP51A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYP51A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYP51A1. This antibody reacts with human. The CYP51A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CYP51A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKML |
|---|
| Other Names | CP51, CYP51Cytochrome P450LI, CYPL1, CYPLI, Cytochrome P450 51A1, cytochrome P450, family 51, subfamily A, polypeptide 1, Cytochrome P450-14DM, EC 1.14.13.70, lanosterol 14-alpha demethylase, lanosterol 14-alpha-demethylase, LDMCytochrome P45014DM, P450-14DM, P450L1,51 (lanosterol 14-alpha-demethylase), Sterol 14-alpha demethylase |
|---|
| Gene, Accession # | CYP51A1, Gene ID: 1595 |
|---|
| Catalog # | NBP2-48793 |
|---|
| Price | |
|---|
| Order / More Info | CYP51A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|