| Edit |   |
|---|
| Antigenic Specificity | PQLC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PQLC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PQLC1. This antibody reacts with human. The PQLC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PQLC1(PQ loop repeat containing 1) The peptide sequence was selected from the middle region of PQLC1. Peptide sequence TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW. |
|---|
| Other Names | FLJ22378, PQ loop repeat containing 1, PQ-loop repeat-containing protein 1 |
|---|
| Gene, Accession # | PQLC1, Gene ID: 80148, Accession: Q8N2U9, SwissProt: Q8N2U9 |
|---|
| Catalog # | NBP1-62482 |
|---|
| Price | |
|---|
| Order / More Info | PQLC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|