| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PR48 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PR48 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PR48. This antibody reacts with human. The PR48 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: B |
|---|
| Immunogen | Synthetic peptides corresponding to PPP2R3B(protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta) The peptide sequence was selected from the C terminal of PPP2R3B. Peptide sequence TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILV |
|---|
| Other Names | FLJ60425, NYREN8, NY-REN-8 antigen, PP2A subunit B isoform PR48, PP2A, subunit B, PR48 isoform, PPP2R3L, PPP2R3LY, PR48, protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta, protein phosphatase 2, regulatory subunit B'', beta, Protein phosphatase 2A 48 kDa regulatory subunit, serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta |
|---|
| Gene, Accession # | PPP2R3B, Gene ID: 28227, Accession: Q9Y5P8, SwissProt: Q9Y5P8 |
|---|
| Catalog # | NBP1-58163 |
|---|
| Price | |
|---|
| Order / More Info | PR48 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|