| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ST6 Gal Sialyltransferase 2/ST6GAL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST6 Gal Sialyltransferase 2/ST6GAL2. This antibody reacts with mouse. The ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the C terminal of St6gal2. Immunizing peptide sequence RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT. |
|---|
| Other Names | Alpha 2,6-ST 2, beta-galactoside alpha-2,6-sialyltransferase 2, beta-galactoside alpha-2,6-sialyltransferase II, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2, EC 2.4.99, EC 2.4.99.1, FLJ30711, FLJ37730, FLJ38334, hST6Gal II, KIAA1877St6gal2, Sialyltransferase 2, sialyltransferase 2 (monosialoganglioside sialyltransferase), SIAT2, ST6 beta-galactosamide alpha-2,6-sialyltranferase 2, ST6Gal II, ST6GALII |
|---|
| Gene, Accession # | ST6GAL2, Gene ID: 84620, Accession: B2RQY9 |
|---|
| Catalog # | NBP1-74154 |
|---|
| Price | |
|---|
| Order / More Info | ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|