| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNHIT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNHIT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNHIT2. This antibody reacts with human. The ZNHIT2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZNHIT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CTPVVPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHGGDDALLSDFCATLLGVSGALGAQQVFASAEEAL |
|---|
| Other Names | C11orf5zinc finger HIT domain-containing protein 2, chromosome 11 open reading frame 5, FONMGC120286, MGC120285, Protein FON, zinc finger, HIT domain containing 2, zinc finger, HIT type 2, zinc finger, HIT-type containing 2 |
|---|
| Gene, Accession # | ZNHIT2, Gene ID: 741, Accession: Q9UHR6, SwissProt: Q9UHR6 |
|---|
| Catalog # | NBP2-34096 |
|---|
| Price | |
|---|
| Order / More Info | ZNHIT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|