| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNRF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNRF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNRF1. This antibody reacts with human. The ZNRF1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZNRF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLPIAPRWFSSHSGFKCPICSKSVASDEMEMHFI |
|---|
| Other Names | DKFZp434E229, EC 6.3.2, EC 6.3.2.-, FLJ14846, MGC15430, nerve injury gene 283, Nerve injury-induced gene 283 protein, nin283, NIN283E3 ubiquitin-protein ligase ZNRF1, zinc and ring finger 1, zinc and ring finger protein 1, Zinc/RING finger protein 1 |
|---|
| Gene, Accession # | ZNRF1, Gene ID: 84937 |
|---|
| Catalog # | NBP1-84196 |
|---|
| Price | |
|---|
| Order / More Info | ZNRF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|