| Edit |   |
|---|
| Antigenic Specificity | ZP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZP4. This antibody reacts with human. The ZP4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ZP4(zona pellucida glycoprotein 4) The peptide sequence was selected from the N terminal of ZP4. Peptide sequence MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT. |
|---|
| Other Names | zinc finger and homeodomain protein 1, zinc fingers and homeobox 1, zinc fingers and homeoboxes 1, zinc fingers and homeoboxes protein 1, zinc-fingers and homeoboxes 1 |
|---|
| Gene, Accession # | ZP4, Gene ID: 57829, Accession: Q12836, SwissProt: Q12836 |
|---|
| Catalog # | NBP1-69341 |
|---|
| Price | |
|---|
| Order / More Info | ZP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|