| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZPBP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZPBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZPBP2. This antibody reacts with human. The ZPBP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZPBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQ |
|---|
| Other Names | CAAX prenyl protease 1 homolog, EC 3.4.24.84, FACE1FLJ14968, FACE-1zinc metalloproteinase (STE24 homolog, yeast), Farnesylated proteins-converting enzyme 1, farnesylated-proteins converting enzyme 1, HGPS, Hutchinson-Gilford progeria syndrome, MADB, Prenyl protein-specific endoprotease 1, PRO1, Ste24p, STE24zinc metallopeptidase (STE24 homolog, yeast), zinc metallopeptidase (STE24 homolog, S. cerevisiae), Zinc metalloproteinase Ste24 homolog |
|---|
| Gene, Accession # | ZPBP2, Gene ID: 124626, Accession: Q6X784, SwissProt: Q6X784 |
|---|
| Catalog # | NBP2-33671 |
|---|
| Price | |
|---|
| Order / More Info | ZPBP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|