| Edit |   |
|---|
| Antigenic Specificity | DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling. |
|---|
| Immunogen | DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM |
|---|
| Other Names | MGC82787|DHX58|lgp2|D11LGP2|D11lgp2e|LGP2|RLR-3|B430001I08Rik|D11Lgp2e|LPG2|Lgp2|RGD1310093 |
|---|
| Gene, Accession # | Gene ID: 79132 |
|---|
| Catalog # | ABIN633307 |
|---|
| Price | |
|---|
| Order / More Info | DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|