Edit |   |
Antigenic Specificity | ZNF134 - middle region |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-ZNF134 Antibody - middle region |
Immunogen | The immunogen for anti-ZNF134 antibody: synthetic peptide directed towards the middle region of human ZNF134. Synthetic peptide located within the following region: TLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ |
Other Names | pHZ15, zinc finger protein 134 |
Gene, Accession # | ZN134, Accession: NM_003435 |
Catalog # | TA344458 |
Price | |
Order / More Info | ZNF134 - middle region Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |