| Edit |   |
|---|
| Antigenic Specificity | ZNF174 - middle region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, dog, guinea pig, porcine, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-ZNF174 Antibody - middle region |
|---|
| Immunogen | The immunogen for anti-ZNF174 antibody: synthetic peptide directed towards the middle region of human ZNF174. Synthetic peptide located within the following region: DNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVS |
|---|
| Other Names | ZSCAN8, zinc finger protein 174 |
|---|
| Gene, Accession # | ZN174, Accession: NM_003450 |
|---|
| Catalog # | TA344455 |
|---|
| Price | |
|---|
| Order / More Info | ZNF174 - middle region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|