| Edit |   |
| Antigenic Specificity | Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | purified |
| Size | 100 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease. |
| Immunogen | SLC25 A16 antibody was raised using the N terminal of SLC25 16 corresponding to a region with amino acids KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM |
| Other Names | gda|gdc|ml7|hml7|hgt.1|d10s105e|3110021G18Rik|GDA|GDC|HGT.1|ML7|D10S105E|hML7|wu:fc33c08|zgc:56187|zgc:77742 |
| Gene, Accession # | Gene ID: 8034,73132,361836 |
| Catalog # | ABIN630321 |
| Price | |
| Order / More Info | Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |