产品详情 |
Edit |   |
Antigenic Specificity | Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, dog, zebrafish |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B. |
Immunogen | EIF2 S3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI |
Other Names | EIF2S3|eif2|eif2g|eif2s3y|eif2gamma|Su(var)3-9|fi03g03|wu:fi03g03|wu:fi37d04|zgc:63805|EIF2|EIF2G|EIF2gamma|eIF-2gA|Eif2g|Eif2s3|PP42|ENSMUSG00000079297 |
Gene, Accession # | Gene ID: 327341,1968,480866,299027 |
Catalog # | ABIN629631 |
Price | |
Order / More Info | Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |
产品资料 |
|
|