Edit |   |
Antigenic Specificity | Acid Phosphatase 6, Lysophosphatidic (ACP6) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence. |
Immunogen | ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFA |
Other Names | ACP6|im:7147584|zgc:172268|MGC146066|ACPL1|LPAP|PACPL1|5730559A09Rik|AU022842|mPACPL1 |
Gene, Accession # | Gene ID: 51205 |
Catalog # | ABIN631264 |
Price | |
Order / More Info | Acid Phosphatase 6, Lysophosphatidic (ACP6) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |