| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DHX57 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DHX57 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHX57. This antibody reacts with human. The DHX57 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DHX57 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATGEEANSNAENPKLISAMLCAALYPNVVQVKSPEGKFQKTSTGAVR |
|---|
| Other Names | DDX57, DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57, DEAH box protein 57, DEAH-box RNA/DNA helicase AAM73547, EC 3.6.1, EC 3.6.4.13, FLJ32861, putative ATP-dependent RNA helicase DHX57 |
|---|
| Gene, Accession # | DHX57, Gene ID: 90957 |
|---|
| Catalog # | NBP1-85267 |
|---|
| Price | |
|---|
| Order / More Info | DHX57 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|