| Edit |   |
|---|
| Antigenic Specificity | TBC1D19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBC1D19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBC1D19. This antibody reacts with human. The TBC1D19 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TBC1D19 (TBC1 domain family, member 19) The peptide sequence was selected from the middle region of TBC1D19. Peptide sequence PVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKEC. |
|---|
| Other Names | FLJ11082, TBC1 domain family member 19, TBC1 domain family, member 19 |
|---|
| Gene, Accession # | TBC1D19, Gene ID: 55296, Accession: Q8N5T2, SwissProt: Q8N5T2 |
|---|
| Catalog # | NBP1-69202 |
|---|
| Price | |
|---|
| Order / More Info | TBC1D19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|