| Edit |   |
| Antigenic Specificity | SGPP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SGPP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SGPP1. This antibody reacts with human, mouse. The SGPP1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human SGPP1. Peptide sequence THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT. |
| Other Names | sphingosine-1-phosphate phosphatase 1 |
| Gene, Accession # | SGPP1, Gene ID: 81537, Accession: NP_110418, SwissProt: NP_110418 |
| Catalog # | NBP1-91353-20ul |
| Price | |
| Order / More Info | SGPP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25908616, 26556954 |