Edit |   |
Antigenic Specificity | Lactamase, beta (LACTB) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins. |
Immunogen | Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE |
Other Names | BA3500|BA2507|PSPTO2834|PSPTO3594|G24|MRPL56|LACT-1|Lact1|Mrpl56|zgc:110419 |
Gene, Accession # | Gene ID: 114294 |
Catalog # | ABIN631100 |
Price | |
Order / More Info | Lactamase, beta (LACTB) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |