| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ropporin 1-like |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ropporin 1-like Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ropporin 1-like. This antibody reacts with human. The Ropporin 1-like Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Ropporin 1-like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV |
|---|
| Other Names | AKAP-associated sperm protein, ASPFLJ23003, FLJ25776, radial spoke head 11 homolog, rhophilin associated tail protein 1-like, ROPN1-like protein, ropporin 1-like, ropporin-1-like protein, RSPH11 |
|---|
| Gene, Accession # | ROPN1L, Gene ID: 83853 |
|---|
| Catalog # | NBP1-90081 |
|---|
| Price | |
|---|
| Order / More Info | Ropporin 1-like Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24518672 |
|---|
| 产品资料 |
|
|