| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Roquin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Roquin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Roquin. This antibody reacts with human. The Roquin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Roquin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG |
|---|
| Other Names | KIAA2025RP5-1198E17.5, RING finger and C3H zinc finger protein 1, ring finger and CCCH-type domains 1, RING finger protein 198, RNF198ring finger and CCCH-type zinc finger domains 1, roquin |
|---|
| Gene, Accession # | RC3H1, Gene ID: 149041 |
|---|
| Catalog # | NBP1-89590 |
|---|
| Price | |
|---|
| Order / More Info | Roquin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23825522 |
|---|
| 产品资料 |
|
|