| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CtBP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CtBP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CtBP1. This antibody reacts with human, mouse, rat. The CtBP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat CtBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
|---|
| Other Names | BARS, brefeldin A-ribosylated substrate, CTBP, CtBP1, C-terminal binding protein 1, C-terminal-binding protein 1, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.158, MGC104684 |
|---|
| Gene, Accession # | CTBP1, Gene ID: 1487, Accession: Q13363, SwissProt: Q13363 |
|---|
| Catalog # | NBP1-88707 |
|---|
| Price | |
|---|
| Order / More Info | CtBP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|