| Edit |   |
|---|
| Antigenic Specificity | Factor II |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Coagulation factor II receptor(F2R) is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. |
|---|
| Immunogen | Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids KYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSW |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN634257 |
|---|
| Price | |
|---|
| Order / More Info | Factor II Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|