| Edit |   |
|---|
| Antigenic Specificity | TBC1D29 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBC1D29 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBC1D29. This antibody reacts with human. The TBC1D29 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TBC1D29 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETWGPATPRALKGTGRARPICESL |
|---|
| Other Names | Putative TBC1 Domain Family Member 29, TBC1 Domain Family, Member 29 |
|---|
| Gene, Accession # | Gene ID: 26083 |
|---|
| Catalog # | NBP2-32437 |
|---|
| Price | |
|---|
| Order / More Info | TBC1D29 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|