| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HPS6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HPS6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HPS6. This antibody reacts with human. The HPS6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HPS6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQ LTPEELRHSSTFRAPQALASILQGHLPPSALLTM |
|---|
| Other Names | FLJ22501, Hermansky-Pudlak syndrome 6, Hermansky-Pudlak syndrome 6 protein, Hermansky-Pudlak syndrome-6 protein (HPS6), MGC20522, RP11-302K17.1, Ru, Ruby-eye protein homolog |
|---|
| Gene, Accession # | HPS6, Gene ID: 79803 |
|---|
| Catalog # | NBP2-14100 |
|---|
| Price | |
|---|
| Order / More Info | HPS6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30387913 |
|---|
| 产品资料 |
|
|