| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRPA1 |
|---|
| Clone | 6G8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, guinea pig |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRPA1 Antibody (6G8) from Novus Biologicals is a mouse monoclonal antibody to TRPA1. This antibody reacts with human, guinea pig. The TRPA1 Antibody (6G8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | TRPA1 (NP_015628 1033 a.a. - 1117 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL |
|---|
| Other Names | ANKTM1ankyrin-like with transmembrane domains 1, Ankyrin-like with transmembrane domains protein 1, Transformation-sensitive protein p120, transient receptor potential cation channel subfamily A member 1, transient receptor potential cation channel, subfamily A, member 1 |
|---|
| Gene, Accession # | TRPA1, Gene ID: 8989, Accession: NP_015628, SwissProt: NP_015628 |
|---|
| Catalog # | H00008989-M03 |
|---|
| Price | |
|---|
| Order / More Info | TRPA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19423751, 27313495 |
|---|
| 产品资料 |
|
|