| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TROVE2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TROVE2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TROVE2. This antibody reacts with human. The TROVE2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to TROVE2 (TROVE domain family, member 2) The peptide sequence was selected from the N terminal of TROVE2. Peptide sequence QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR. |
|---|
| Other Names | 60 kDa ribonucleoprotein Ro, 60 kDa Ro protein, 60 kDa SS-A/Ro ribonucleoprotein, Ro 60 kDa autoantigen, RO60gastric cancer multi-drug resistance protein, RORNP, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS-A/Ro), SS-A, SSA2Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro), TROVE domain family member 2, TROVE domain family, member 2 |
|---|
| Gene, Accession # | TROVE2, Gene ID: 6738, Accession: Q5LJA0, SwissProt: Q5LJA0 |
|---|
| Catalog # | NBP1-57301 |
|---|
| Price | |
|---|
| Order / More Info | TROVE2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|