| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC45A3/Prostein |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC45A3/Prostein Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC45A3/Prostein. This antibody reacts with human. The SLC45A3/Prostein Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC45A3/Prostein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP |
| Other Names | IPCA-2, IPCA-6, IPCA-8, PCANAP6IPCA6, PCANAP8, prostate cancer associated protein 2, prostate cancer associated protein 6, prostate cancer associated protein 8, prostate cancer-associated gene 2, prostate cancer-associated gene 6, prostate cancer-associated gene 8, Prostate cancer-associated protein 6, Prostein, PRSTPCANAP2, solute carrier family 45 member 3, solute carrier family 45, member 3 |
| Gene, Accession # | SLC45A3, Gene ID: 85414 |
| Catalog # | NBP1-89629 |
| Price | |
| Order / More Info | SLC45A3/Prostein Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|