| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC45A3/Prostein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC45A3/Prostein Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC45A3/Prostein. This antibody reacts with human. The SLC45A3/Prostein Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC45A3(solute carrier family 45, member 3) The peptide sequence was selected from the middle region of SLC45A3. Peptide sequence LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS. |
|---|
| Other Names | IPCA-2, IPCA-6, IPCA-8, PCANAP6IPCA6, PCANAP8, prostate cancer associated protein 2, prostate cancer associated protein 6, prostate cancer associated protein 8, prostate cancer-associated gene 2, prostate cancer-associated gene 6, prostate cancer-associated gene 8, Prostate cancer-associated protein 6, Prostein, PRSTPCANAP2, solute carrier family 45 member 3, solute carrier family 45, member 3 |
|---|
| Gene, Accession # | SLC45A3, Gene ID: 85414, Accession: Q96JT2, SwissProt: Q96JT2 |
|---|
| Catalog # | NBP1-69294 |
|---|
| Price | |
|---|
| Order / More Info | SLC45A3/Prostein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|