| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | p21/CIP1/CDKN1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The p21/CIP1/CDKN1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to p21/CIP1/CDKN1A. This antibody reacts with human. The p21/CIP1/CDKN1A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human p21/CIP1/CDKN1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKR |
|---|
| Other Names | CAP20cyclin-dependent kinase inhibitor 1, CDK-interacting protein 1, CDKN1melanoma differentiation associated protein 6, CIP1WAF1CDK-interaction protein 1, cyclin-dependent kinase inhibitor 1A (p21, Cip1), MDA6, MDA-6, Melanoma differentiation-associated protein 6, p21, p21CIP1, p21Cip1/Waf1, PIC1, SDI1DNA synthesis inhibitor, wild-type p53-activated fragment 1 |
|---|
| Gene, Accession # | CDKN1A, Gene ID: 1026 |
|---|
| Catalog # | NBP2-58874 |
|---|
| Price | |
|---|
| Order / More Info | p21/CIP1/CDKN1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|